Lineage for d1nfda2 (1nfd A:118-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160265Protein T-cell antigen receptor [49125] (6 species)
  7. 160293Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)
  8. 160297Domain d1nfda2: 1nfd A:118-213 [21550]
    Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2

Details for d1nfda2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfda2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1nfda2:

Click to download the PDB-style file with coordinates for d1nfda2.
(The format of our PDB-style files is described here.)

Timeline for d1nfda2: