SCOPe 2.07: Domain d3qzeb_: 3qze B:

Lineage for d3qzeb_ (3qze B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [226142] (2 PDB entries)

8. Domain d3qzeb_: 3qze B: [215499]
   automated match to d3flud_
   complexed with cl

Details for d3qzeb_

PDB Entry: 3qze, 1.59 Å

PDB Description: crystal structure of dapa (pa1010) at 1.6 a resolution

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3qzeb_:

Sequence; same for both SEQRES and ATOM records:

>d3qzeb_ c.1.10.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
iagsmvalvtpfdaqgrldwdslaklvdfhlqegtnaivavgttgesatldveehiqvir
rvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfrh
iaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkdf
lvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplhk
alfiesnpipvkwalhemglipegirlpltwlsprcheplrqamrqtgvl

Timeline for d3qzeb_:

• d3qzeb_ first appeared in SCOPe 2.03
  
• d3qzeb_ appears in SCOPe 2.06
  
• d3qzeb_ appears in the current release, SCOPe 2.08