Lineage for d3qzaa_ (3qza A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345125Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1345176Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1345363Protein automated matches [190298] (1 species)
    not a true protein
  7. 1345364Species Streptomyces rubiginosus [TaxId:1929] [187248] (15 PDB entries)
  8. 1345378Domain d3qzaa_: 3qza A: [215497]
    automated match to d2glka_
    complexed with d8u, dod

Details for d3qzaa_

PDB Entry: 3qza (more details), 2 Å

PDB Description: joint neutron and x-ray structure of apo-d-xylose isomerase at ph=5.9
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d3qzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qzaa_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d3qzaa_:

Click to download the PDB-style file with coordinates for d3qzaa_.
(The format of our PDB-style files is described here.)

Timeline for d3qzaa_: