Lineage for d3qysa_ (3qys A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825255Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1825306Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1825507Protein automated matches [190298] (1 species)
    not a true protein
  7. 1825508Species Streptomyces rubiginosus [TaxId:1929] [187248] (15 PDB entries)
  8. 1825517Domain d3qysa_: 3qys A: [215494]
    automated match to d2glka_
    complexed with ni

Details for d3qysa_

PDB Entry: 3qys (more details), 1.85 Å

PDB Description: Room Temperature X-ray Structure of D-Xylose Isomerase in complex with 0.6Ni2+ cation bound in M2 metal binding site at pH=5.8
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d3qysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qysa_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d3qysa_:

Click to download the PDB-style file with coordinates for d3qysa_.
(The format of our PDB-style files is described here.)

Timeline for d3qysa_: