Lineage for d3qyia_ (3qyi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2982066Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries)
  8. 2982120Domain d3qyia_: 3qyi A: [215491]
    automated match to d3erka_
    complexed with pg4, q23

Details for d3qyia_

PDB Entry: 3qyi (more details), 2.18 Å

PDB Description: map kinase erk2 complexed with 1,1-dioxo-2,3-dihydrothiophen-3-yl benzenesulfonate
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d3qyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyia_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp

SCOPe Domain Coordinates for d3qyia_:

Click to download the PDB-style file with coordinates for d3qyia_.
(The format of our PDB-style files is described here.)

Timeline for d3qyia_: