Lineage for d3qwzb_ (3qwz B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893443Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 1893463Protein automated matches [191298] (1 species)
    not a true protein
  7. 1893464Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)
  8. 1893468Domain d3qwzb_: 3qwz B: [215481]
    Other proteins in same PDB: d3qwza1, d3qwza2
    automated match to d3qx1a_

Details for d3qwzb_

PDB Entry: 3qwz (more details), 2 Å

PDB Description: Crystal structure of FAF1 UBX-p97N-domain complex
PDB Compounds: (B:) fas-associated factor 1

SCOPe Domain Sequences for d3qwzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwzb_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp
nksllevklfpqetlfleake

SCOPe Domain Coordinates for d3qwzb_:

Click to download the PDB-style file with coordinates for d3qwzb_.
(The format of our PDB-style files is described here.)

Timeline for d3qwzb_: