Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.2: UBX domain [54250] (6 proteins) Pfam PF00789 |
Protein automated matches [191298] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries) |
Domain d3qwzb_: 3qwz B: [215481] Other proteins in same PDB: d3qwza1, d3qwza2 automated match to d3qx1a_ |
PDB Entry: 3qwz (more details), 2 Å
SCOPe Domain Sequences for d3qwzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qwzb_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp nksllevklfpqetlfleake
Timeline for d3qwzb_: