Lineage for d1cqkb_ (1cqk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748774Species Mouse (Mus musculus) [TaxId:10090] [88591] (2 PDB entries)
  8. 2748776Domain d1cqkb_: 1cqk B: [21548]
    CH-gamma-3 domain only from antibody MAK33

Details for d1cqkb_

PDB Entry: 1cqk (more details), 2.2 Å

PDB Description: crystal structure of the ch3 domain from the mak33 antibody
PDB Compounds: (B:) ch3 domain of mak33 antibody

SCOPe Domain Sequences for d1cqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqkb_ b.1.1.2 (B:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]}
paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
syfvysklnvqksnweagntftcsvlheglhnhhtekslsh

SCOPe Domain Coordinates for d1cqkb_:

Click to download the PDB-style file with coordinates for d1cqkb_.
(The format of our PDB-style files is described here.)

Timeline for d1cqkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cqka_