Lineage for d3qwid_ (3qwi D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107434Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 2107449Domain d3qwid_: 3qwi D: [215478]
    automated match to d3uvea_
    complexed with cue, edo, nap

Details for d3qwid_

PDB Entry: 3qwi (more details), 2.5 Å

PDB Description: crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with nadph and coumestrol
PDB Compounds: (D:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d3qwid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwid_ c.2.1.0 (D:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa

SCOPe Domain Coordinates for d3qwid_:

Click to download the PDB-style file with coordinates for d3qwid_.
(The format of our PDB-style files is described here.)

Timeline for d3qwid_: