SCOPe 2.04: Domain d3qwid_: 3qwi D:

Lineage for d3qwid_ (3qwi D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)

8. Domain d3qwid_: 3qwi D: [215478]
   automated match to d3uvea_
   complexed with cue, edo, nap

Details for d3qwid_

PDB Entry: 3qwi, 2.5 Å

PDB Description: crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with nadph and coumestrol

PDB Compounds: (D:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d3qwid_:

Sequence; same for both SEQRES and ATOM records:

>d3qwid_ c.2.1.0 (D:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa

Timeline for d3qwid_:

• d3qwid_ first appeared in SCOPe 2.03
  
• d3qwid_ appears in SCOPe 2.05
  
• d3qwid_ appears in the current release, SCOPe 2.08