Lineage for d3qwhb_ (3qwh B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350329Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 1350358Domain d3qwhb_: 3qwh B: [215472]
    automated match to d3uvea_
    complexed with kmp, nap, peg

Details for d3qwhb_

PDB Entry: 3qwh (more details), 2.62 Å

PDB Description: crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with nadph and kaempferol
PDB Compounds: (B:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d3qwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwhb_ c.2.1.0 (B:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa

SCOPe Domain Coordinates for d3qwhb_:

Click to download the PDB-style file with coordinates for d3qwhb_.
(The format of our PDB-style files is described here.)

Timeline for d3qwhb_: