| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries) |
| Domain d3qwfg_: 3qwf G: [215469] automated match to d3uvea_ complexed with gol, nap |
PDB Entry: 3qwf (more details), 1.88 Å
SCOPe Domain Sequences for d3qwfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qwfg_ c.2.1.0 (G:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa
Timeline for d3qwfg_: