Lineage for d3qwfa_ (3qwf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454994Species Cochliobolus lunatus [TaxId:5503] [225937] (9 PDB entries)
  8. 2454995Domain d3qwfa_: 3qwf A: [215463]
    automated match to d3uvea_
    complexed with gol, nap

Details for d3qwfa_

PDB Entry: 3qwf (more details), 1.88 Å

PDB Description: Crystal structure of the 17beta-hydroxysteroid dehydrogenase from Cochliobolus lunatus
PDB Compounds: (A:) 17beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d3qwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwfa_ c.2.1.0 (A:) automated matches {Cochliobolus lunatus [TaxId: 5503]}
tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
lvskegewvngkvltldggaa

SCOPe Domain Coordinates for d3qwfa_:

Click to download the PDB-style file with coordinates for d3qwfa_.
(The format of our PDB-style files is described here.)

Timeline for d3qwfa_: