SCOPe 2.06: Domain d3qvva_: 3qvv A:

Lineage for d3qvva_ (3qvv A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein automated matches [190189] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)

8. Domain d3qvva_: 3qvv A: [215461]
   automated match to d3qvub_
   complexed with 3qv, a3p

Details for d3qvva_

PDB Entry: 3qvv, 2.35 Å

PDB Description: Crystal structure of Ancestral variant b9 of SULT 1A1 in complex with PAP and 3-CyC

PDB Compounds: (A:) Sulfotransferase 1A1

SCOPe Domain Sequences for d3qvva_:

Sequence; same for both SEQRES and ATOM records:

>d3qvva_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttipqei
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

Timeline for d3qvva_:

• d3qvva_ first appeared in SCOPe 2.03
  
• d3qvva_ appears in SCOPe 2.05
  
• d3qvva_ appears in SCOPe 2.07
  
• d3qvva_ appears in the current release, SCOPe 2.08