Lineage for d3qvta2 (3qvt A:228-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962094Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2962095Species Archaeoglobus fulgidus [TaxId:2234] [111049] (3 PDB entries)
    Uniprot O28480
  8. 2962101Domain d3qvta2: 3qvt A:228-332 [215460]
    Other proteins in same PDB: d3qvta1
    automated match to d1u1ia2
    complexed with gol, kpg, na, nai, pg4, po4

Details for d3qvta2

PDB Entry: 3qvt (more details), 2 Å

PDB Description: l-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus wild- type with the intermediate 5-keto 1-phospho glucose
PDB Compounds: (A:) Myo-inositol-1-phosphate synthase (Ino1)

SCOPe Domain Sequences for d3qvta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvta2 d.81.1.3 (A:228-332) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]}
tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg
yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid

SCOPe Domain Coordinates for d3qvta2:

Click to download the PDB-style file with coordinates for d3qvta2.
(The format of our PDB-style files is described here.)

Timeline for d3qvta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qvta1