SCOPe 2.08: Domain d1pfca_: 1pfc A:

Lineage for d1pfca_ (1pfc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [49123] (1 PDB entry)

8. Domain d1pfca_: 1pfc A: [21546]
   CH-gamma-3 domain only

Details for d1pfca_

PDB Entry: 1pfc, 3.12 Å

PDB Description: molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution

PDB Compounds: (A:) igg1 pfc' fc

SCOPe Domain Sequences for d1pfca_:

Sequence; same for both SEQRES and ATOM records:

>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]}
rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp
pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg

Timeline for d1pfca_:

• d1pfca_ first appeared (with stable ids) in SCOP 1.55, called d1pfc__
  
• d1pfca_ appears in SCOPe 2.07