![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Guinea pig (Cavia porcellus) [TaxId:10141] [49123] (1 PDB entry) |
![]() | Domain d1pfca_: 1pfc A: [21546] CH-gamma-3 domain only |
PDB Entry: 1pfc (more details), 3.12 Å
SCOPe Domain Sequences for d1pfca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} rtiskakgppripevyllppprnelskkkvsltcmitgfypadinvewdssepsdykntp pvfdtdgsfflysrlkvdtdawnngesftcsvmhealpnhviqksisrspg
Timeline for d1pfca_: