Lineage for d3qvsa1 (3qvs A:1-227,A:333-392)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452414Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 2452415Species Archaeoglobus fulgidus [TaxId:2234] [110418] (3 PDB entries)
    Uniprot O28480
  8. 2452416Domain d3qvsa1: 3qvs A:1-227,A:333-392 [215457]
    Other proteins in same PDB: d3qvsa2
    automated match to d1u1ia1
    complexed with gol, na, nad, pg4, po4

Details for d3qvsa1

PDB Entry: 3qvs (more details), 1.7 Å

PDB Description: l-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus wild type
PDB Compounds: (A:) Myo-inositol-1-phosphate synthase (Ino1)

SCOPe Domain Sequences for d3qvsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvsa1 c.2.1.3 (A:1-227,A:333-392) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]}
mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgkXaivaaplildia
rfllfakkkgvkgvvkemafffkspmdtnvintheqfvvlkewysnlk

SCOPe Domain Coordinates for d3qvsa1:

Click to download the PDB-style file with coordinates for d3qvsa1.
(The format of our PDB-style files is described here.)

Timeline for d3qvsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qvsa2