![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [110418] (3 PDB entries) Uniprot O28480 |
![]() | Domain d3qvsa1: 3qvs A:1-227,A:333-392 [215457] Other proteins in same PDB: d3qvsa2 automated match to d1u1ia1 complexed with gol, na, nad, pg4, po4 |
PDB Entry: 3qvs (more details), 1.7 Å
SCOPe Domain Sequences for d3qvsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvsa1 c.2.1.3 (A:1-227,A:333-392) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgkXaivaaplildia rfllfakkkgvkgvvkemafffkspmdtnvintheqfvvlkewysnlk
Timeline for d3qvsa1: