Lineage for d3qvra2 (3qvr A:325-520)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180485Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2180513Protein Glucose oxidase [54391] (2 species)
  7. 2180514Species Aspergillus niger [TaxId:5061] [54392] (4 PDB entries)
  8. 2180516Domain d3qvra2: 3qvr A:325-520 [215456]
    Other proteins in same PDB: d3qvra1
    automated match to d1cf3a2
    complexed with cl, fad, nag

Details for d3qvra2

PDB Entry: 3qvr (more details), 1.3 Å

PDB Description: crystal structure of glucose oxidase for space group p3121 at 1.3 a resolution.
PDB Compounds: (A:) glucose oxidase

SCOPe Domain Sequences for d3qvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvra2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]}
nlqdqttatvrsritsagagqgqaawfatfnetfgdysekahellntkleqwaeeavarg
gfhnttalliqyenyrdwivnhnvayselfldtagvasfdvwdllpftrgyvhildkdpy
lhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlaydadlsawt
eyipyhfrpnyhgvgt

SCOPe Domain Coordinates for d3qvra2:

Click to download the PDB-style file with coordinates for d3qvra2.
(The format of our PDB-style files is described here.)

Timeline for d3qvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qvra1