Lineage for d3qvpa1 (3qvp A:3-324,A:521-583)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351504Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1351543Protein Glucose oxidase [51924] (2 species)
  7. 1351544Species Aspergillus niger [TaxId:5061] [51925] (4 PDB entries)
  8. 1351545Domain d3qvpa1: 3qvp A:3-324,A:521-583 [215453]
    Other proteins in same PDB: d3qvpa2
    automated match to d1cf3a1
    complexed with cl, fad, gol, nag, peg

Details for d3qvpa1

PDB Entry: 3qvp (more details), 1.2 Å

PDB Description: crystal structure of glucose oxidase for space group c2221 at 1.2 a resolution
PDB Compounds: (A:) glucose oxidase

SCOPe Domain Sequences for d3qvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvpa1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}
gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
igmksileplgidtvvdlpvglXcsmmpkemggvvdnaarvygvqglrvidgsipptqms
shvmtvfyamalkisdailedyasmq

SCOPe Domain Coordinates for d3qvpa1:

Click to download the PDB-style file with coordinates for d3qvpa1.
(The format of our PDB-style files is described here.)

Timeline for d3qvpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qvpa2