Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88593] (3 PDB entries) |
Domain d1frtc2: 1frt C:342-443 [21545] Other proteins in same PDB: d1frta1, d1frta2, d1frtb_, d1frtc1 part of a Fc complexed with nag |
PDB Entry: 1frt (more details), 4.5 Å
SCOPe Domain Sequences for d1frtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1frtc2 b.1.1.2 (C:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1frtc2: