Lineage for d3qv8a2 (3qv8 A:358-498)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120383Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2120384Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2120385Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2120386Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2120486Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 2120517Domain d3qv8a2: 3qv8 A:358-498 [215447]
    Other proteins in same PDB: d3qv8a1, d3qv8d1, d3qv8d2
    automated match to d1pkla3
    complexed with po4, s62

Details for d3qv8a2

PDB Entry: 3qv8 (more details), 2.45 Å

PDB Description: Crystal structure of Leishmania mexicana pyruvate kinase(LmPYK)in complex with benzothiazole-2,5-disulfonic acid.
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3qv8a2:

Sequence, based on SEQRES records: (download)

>d3qv8a2 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d3qv8a2 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihaanqtrillve

SCOPe Domain Coordinates for d3qv8a2:

Click to download the PDB-style file with coordinates for d3qv8a2.
(The format of our PDB-style files is described here.)

Timeline for d3qv8a2: