![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) ![]() |
![]() | Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
![]() | Protein Pyruvate kinase (PK) [50802] (6 species) |
![]() | Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries) |
![]() | Domain d3qv7d2: 3qv7 D:88-186 [215444] Other proteins in same PDB: d3qv7a1, d3qv7a3, d3qv7b1, d3qv7b2, d3qv7c1, d3qv7c2, d3qv7d1, d3qv7d3 automated match to d1pkla1 complexed with k, qv7, qv8, so4 |
PDB Entry: 3qv7 (more details), 2.7 Å
SCOPe Domain Sequences for d3qv7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qv7d2 b.58.1.1 (D:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl
Timeline for d3qv7d2: