| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) ![]() |
| Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
| Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
| Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries) |
| Domain d3qv7c2: 3qv7 C:358-498 [215442] Other proteins in same PDB: d3qv7a1, d3qv7a2, d3qv7b1, d3qv7c1, d3qv7d1, d3qv7d2 automated match to d1pkla3 complexed with k, qv7, qv8, so4 |
PDB Entry: 3qv7 (more details), 2.7 Å
SCOPe Domain Sequences for d3qv7c2:
Sequence, based on SEQRES records: (download)
>d3qv7c2 c.49.1.1 (C:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve
>d3qv7c2 c.49.1.1 (C:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadgyanqtrillve
Timeline for d3qv7c2: