Lineage for d3qv7b2 (3qv7 B:358-498)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603561Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1603562Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1603563Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1603564Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1603652Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 1603686Domain d3qv7b2: 3qv7 B:358-498 [215440]
    Other proteins in same PDB: d3qv7a1, d3qv7a2, d3qv7b1, d3qv7c1, d3qv7d1, d3qv7d2
    automated match to d1pkla3
    complexed with k, qv7, qv8, so4

Details for d3qv7b2

PDB Entry: 3qv7 (more details), 2.7 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase(lmpyk)in complex with ponceau s and acid blue 25.
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d3qv7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qv7b2 c.49.1.1 (B:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

SCOPe Domain Coordinates for d3qv7b2:

Click to download the PDB-style file with coordinates for d3qv7b2.
(The format of our PDB-style files is described here.)

Timeline for d3qv7b2: