Lineage for d1frtc1 (1frt C:239-341)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221775Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 221784Domain d1frtc1: 1frt C:239-341 [21544]
    Other proteins in same PDB: d1frta1, d1frta2, d1frtb_

Details for d1frtc1

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

SCOP Domain Sequences for d1frtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frtc1 b.1.1.2 (C:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyns
tyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1frtc1:

Click to download the PDB-style file with coordinates for d1frtc1.
(The format of our PDB-style files is described here.)

Timeline for d1frtc1: