SCOP 1.63: Domain d1frtc1: 1frt C:239-341

Lineage for d1frtc1 (1frt C:239-341)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fc (rat) IgG [49122] (3 PDB entries)

8. Domain d1frtc1: 1frt C:239-341 [21544]
   Other proteins in same PDB: d1frta1, d1frta2, d1frtb_

Details for d1frtc1

PDB Entry: 1frt, 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

SCOP Domain Sequences for d1frtc1:

Sequence; same for both SEQRES and ATOM records:

>d1frtc1 b.1.1.2 (C:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyns
tyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1frtc1:

• d1frtc1 first appeared (with stable ids) in SCOP 1.55
  
• d1frtc1 appears in SCOP 1.61
  
• d1frtc1 appears in SCOP 1.65
  
• d1frtc1 appears in the current release, SCOPe 2.08