Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fc (rat) IgG [49122] (3 PDB entries) |
Domain d1i1ad2: 1i1a D:342-443 [21543] Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_ complexed with cys, fuc, man, nag; mutant |
PDB Entry: 1i1a (more details), 2.8 Å
SCOP Domain Sequences for d1i1ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ad2 b.1.1.2 (D:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG} tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd gsyflysklnvkketwqqgntftcsvlheglenehtekslsh
Timeline for d1i1ad2: