SCOPe 2.06: Domain d3quvb1: 3quv B:1-231

Lineage for d3quvb1 (3quv B:1-231)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (16 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [226092] (1 PDB entry)

8. Domain d3quvb1: 3quv B:1-231 [215429]
   Other proteins in same PDB: d3quva2, d3quvb2
   automated match to d1oy5a_
   complexed with edo

Details for d3quvb1

PDB Entry: 3quv, 1.7 Å

PDB Description: crystal structure of a trna-guanine-n1-methyltransferase from mycobacterium abscessus

PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d3quvb1:

Sequence, based on SEQRES records:

>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmaslle
gpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds

Sequence, based on observed residues (ATOM records):

>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaasllegpsytrpps
wrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds

Timeline for d3quvb1:

• d3quvb1 first appeared in SCOPe 2.03, called d3quvb_
  
• d3quvb1 was called d3quvb_ in SCOPe 2.05
  
• d3quvb1 appears in SCOPe 2.07
  
• d3quvb1 appears in the current release, SCOPe 2.08