Lineage for d3quva_ (3quv A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884797Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 1884798Protein automated matches [190961] (13 species)
    not a true protein
  7. 1884839Species Mycobacterium abscessus [TaxId:561007] [226092] (1 PDB entry)
  8. 1884840Domain d3quva_: 3quv A: [215428]
    automated match to d1oy5a_
    complexed with edo

Details for d3quva_

PDB Entry: 3quv (more details), 1.7 Å

PDB Description: crystal structure of a trna-guanine-n1-methyltransferase from mycobacterium abscessus
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d3quva_:

Sequence, based on SEQRES records: (download)

>d3quva_ c.116.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gsmkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpg
mvmkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrv
addaatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmasl
legpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdll

Sequence, based on observed residues (ATOM records): (download)

>d3quva_ c.116.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gsmkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpg
mvmkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrv
addaatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnasllegpsytrppswr
gmdvppvllsgdhakiaawraeqsrqrtierrpdll

SCOPe Domain Coordinates for d3quva_:

Click to download the PDB-style file with coordinates for d3quva_.
(The format of our PDB-style files is described here.)

Timeline for d3quva_: