Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
Domain d3quqa1: 3quq A:1-224 [215427] Other proteins in same PDB: d3quqa2 automated match to d2hi0b_ complexed with cl, fmt, mg, unl |
PDB Entry: 3quq (more details), 1.65 Å
SCOPe Domain Sequences for d3quqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3quqa1 c.108.1.0 (A:1-224) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} mrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfq relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
Timeline for d3quqa1: