SCOPe 2.08: Domain d3quqa1: 3quq A:1-224

Lineage for d3quqa1 (3quq A:1-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)

8. Domain d3quqa1: 3quq A:1-224 [215427]
   Other proteins in same PDB: d3quqa2
   automated match to d2hi0b_
   complexed with cl, fmt, mg, unl

Details for d3quqa1

PDB Entry: 3quq, 1.65 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3quqa1:

Sequence; same for both SEQRES and ATOM records:

>d3quqa1 c.108.1.0 (A:1-224) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfq
relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl
lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag
hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml

Timeline for d3quqa1:

• d3quqa1 first appeared in SCOPe 2.03, called d3quqa_
  
• d3quqa1 appears in SCOPe 2.07