| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
| Domain d3quba_: 3qub A: [215423] automated match to d2hi0b_ complexed with so4; mutant |
PDB Entry: 3qub (more details), 1.9 Å
SCOPe Domain Sequences for d3quba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3quba_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhagrtgastinivfq
relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl
lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag
hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtim
Timeline for d3quba_: