SCOPe 2.06: Domain d3qu2d_: 3qu2 D:

Lineage for d3qu2d_ (3qu2 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)

8. Domain d3qu2d_: 3qu2 D: [215422]
   automated match to d2hi0b_
   complexed with cit, cl, gol, mg

Details for d3qu2d_

PDB Entry: 3qu2, 1.95 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation

PDB Compounds: (D:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3qu2d_:

Sequence; same for both SEQRES and ATOM records:

>d3qu2d_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml

Timeline for d3qu2d_:

• d3qu2d_ first appeared in SCOPe 2.03
  
• d3qu2d_ appears in SCOPe 2.05
  
• d3qu2d_ appears in SCOPe 2.07
  
• d3qu2d_ appears in the current release, SCOPe 2.08