Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (49 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
Domain d3qu2d_: 3qu2 D: [215422] automated match to d2hi0b_ complexed with cit, cl, gol, mg |
PDB Entry: 3qu2 (more details), 1.95 Å
SCOPe Domain Sequences for d3qu2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qu2d_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
Timeline for d3qu2d_: