Lineage for d3qu2d_ (3qu2 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1883904Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 1883939Domain d3qu2d_: 3qu2 D: [215422]
    automated match to d2hi0b_
    complexed with cit, cl, gol, mg

Details for d3qu2d_

PDB Entry: 3qu2 (more details), 1.95 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation
PDB Compounds: (D:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3qu2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qu2d_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
klkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqrel
gkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsller
lehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghka
giftiavntgpldgqvlldagadllfpsmqtlcdswdtiml

SCOPe Domain Coordinates for d3qu2d_:

Click to download the PDB-style file with coordinates for d3qu2d_.
(The format of our PDB-style files is described here.)

Timeline for d3qu2d_: