Lineage for d1i1ad1 (1i1a D:239-341)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655856Species Rat (Rattus norvegicus) [TaxId:10116] [88588] (2 PDB entries)
  8. 655860Domain d1i1ad1: 1i1a D:239-341 [21542]
    Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_, d1i1ac2, d1i1ad2
    part of a Fc
    complexed with cys, fuc, man, nag; mutant

Details for d1i1ad1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
PDB Compounds: (D:) ig gamma-2a chain c region

SCOP Domain Sequences for d1i1ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ad1 b.1.1.2 (D:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

SCOP Domain Coordinates for d1i1ad1:

Click to download the PDB-style file with coordinates for d1i1ad1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ad1: