SCOP 1.63: Domain d1i1ad1: 1i1a D:239-341

Lineage for d1i1ad1 (1i1a D:239-341)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Fc (rat) IgG [49122] (3 PDB entries)
Domain d1i1ad1: 1i1a D:239-341 [21542]
Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_

Details for d1i1ad1

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ad1 b.1.1.2 (D:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg

SCOP Domain Coordinates for d1i1ad1:

Click to download the PDB-style file with coordinates for d1i1ad1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ad1: