SCOPe 2.05: Domain d3qtya1: 3qty A:0-170

Lineage for d3qtya1 (3qty A:0-170)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (8 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [226090] (1 PDB entry)

8. Domain d3qtya1: 3qty A:0-170 [215415]
   Other proteins in same PDB: d3qtya2, d3qtyb2
   automated match to d1clia1
   complexed with fmt, po4, pop, so4, trs

Details for d3qtya1

PDB Entry: 3qty, 1.8 Å

PDB Description: Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate

PDB Compounds: (A:) Phosphoribosylaminoimidazol (AIR) synthetase

SCOPe Domain Sequences for d3qtya1:

Sequence; same for both SEQRES and ATOM records:

>d3qtya1 d.79.4.0 (A:0-170) automated matches {Francisella tularensis [TaxId: 119856]}
amaglkyedagvnieagnqavermkqhvkktftqdvltglgsfgslyslkniinnyddpv
lvqsidgvgtktkvavmcgkfenlgydlfsaatndivvmgakpitfldyvahdkldpaim
eelvkgmskacaecgvslvggetaempgvyqageidmvgvitgivdrkrii

Timeline for d3qtya1:

• d3qtya1 first appeared in SCOPe 2.03
  
• d3qtya1 appears in SCOPe 2.04
  
• d3qtya1 appears in SCOPe 2.06
  
• d3qtya1 appears in the current release, SCOPe 2.08