Lineage for d3qttb_ (3qtt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106117Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)
  8. 2106121Domain d3qttb_: 3qtt B: [215411]
    automated match to d3n8hb_
    complexed with anp, bal, mg, pro

Details for d3qttb_

PDB Entry: 3qtt (more details), 2.6 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis complexed with beta-gamma atp and beta-alanine
PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d3qttb_:

Sequence, based on SEQRES records: (download)

>d3qttb_ c.26.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
lafyigkvrlidnflketgps

Sequence, based on observed residues (ATOM records): (download)

>d3qttb_ c.26.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
lafyigkvrlidnflkeps

SCOPe Domain Coordinates for d3qttb_:

Click to download the PDB-style file with coordinates for d3qttb_.
(The format of our PDB-style files is described here.)

Timeline for d3qttb_: