Lineage for d3qtta_ (3qtt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860944Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)
  8. 2860949Domain d3qtta_: 3qtt A: [215410]
    automated match to d3n8hb_
    complexed with anp, bal, mg, pro

Details for d3qtta_

PDB Entry: 3qtt (more details), 2.6 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis complexed with beta-gamma atp and beta-alanine
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3qtta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtta_ c.26.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
lafyigkvrlidnflketgps

SCOPe Domain Coordinates for d3qtta_:

Click to download the PDB-style file with coordinates for d3qtta_.
(The format of our PDB-style files is described here.)

Timeline for d3qtta_: