SCOPe 2.03: Domain d1i1ac2: 1i1a C:342-443

Lineage for d1i1ac2 (1i1a C:342-443)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88593] (3 PDB entries)

8. Domain d1i1ac2: 1i1a C:342-443 [21541]
   Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_, d1i1ac1, d1i1ad1
   part of a Fc
   complexed with cys, nag, ndg

Details for d1i1ac2

PDB Entry: 1i1a, 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

PDB Compounds: (C:) ig gamma-2a chain c region

SCOPe Domain Sequences for d1i1ac2:

Sequence; same for both SEQRES and ATOM records:

>d1i1ac2 b.1.1.2 (C:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglhnhhtekslsh

Timeline for d1i1ac2:

• d1i1ac2 first appeared (with stable ids) in SCOP 1.55
  
• d1i1ac2 appears in SCOPe 2.02
  
• d1i1ac2 appears in SCOPe 2.04
  
• d1i1ac2 appears in the current release, SCOPe 2.08