Lineage for d1i1ac2 (1i1a C:342-443)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221775Species Fc (rat) IgG [49122] (3 PDB entries)
  8. 221781Domain d1i1ac2: 1i1a C:342-443 [21541]
    Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_

Details for d1i1ac2

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ac2 b.1.1.2 (C:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglhnhhtekslsh

SCOP Domain Coordinates for d1i1ac2:

Click to download the PDB-style file with coordinates for d1i1ac2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ac2: