| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
| Protein Sarcosine oxidase [54388] (1 species) |
| Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries) |
| Domain d3qssa2: 3qss A:218-321 [215400] Other proteins in same PDB: d3qssa1, d3qssb1 automated match to d1l9ea2 complexed with cl, fad, mtg |
PDB Entry: 3qss (more details), 1.85 Å
SCOPe Domain Sequences for d3qssa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qssa2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d3qssa2: