![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
![]() | Species Fc (rat) IgG [49122] (3 PDB entries) |
![]() | Domain d1i1ac1: 1i1a C:239-341 [21540] Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab1 |
PDB Entry: 1i1a (more details), 2.8 Å
SCOP Domain Sequences for d1i1ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ac1 b.1.1.2 (C:239-341) Immunoglobulin (constant domains of L and H chains) {Fc (rat) IgG} svfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns tlrsvselpivhrdwlngktfkckvnsgafpapieksiskpeg
Timeline for d1i1ac1: