| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88588] (3 PDB entries) |
| Domain d1i1ac1: 1i1a C:239-341 [21540] Other proteins in same PDB: d1i1aa1, d1i1aa2, d1i1ab_, d1i1ac2, d1i1ad2 part of a Fc complexed with cys, nag |
PDB Entry: 1i1a (more details), 2.8 Å
SCOPe Domain Sequences for d1i1ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ac1 b.1.1.2 (C:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
svfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
tlrsvselpivhrdwlngktfkckvnsgafpapieksiskpeg
Timeline for d1i1ac1: