Lineage for d3qsmb1 (3qsm B:1-217,B:322-387)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849717Protein Sarcosine oxidase [51920] (1 species)
  7. 2849718Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (17 PDB entries)
  8. 2849728Domain d3qsmb1: 3qsm B:1-217,B:322-387 [215397]
    Other proteins in same PDB: d3qsma2, d3qsmb2
    automated match to d1l9ea1
    complexed with cl, fad

Details for d3qsmb1

PDB Entry: 3qsm (more details), 1.9 Å

PDB Description: Crystal structure for the MSOX.chloride binary complex
PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d3qsmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsmb1 c.3.1.2 (B:1-217,B:322-387) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslqkt

SCOPe Domain Coordinates for d3qsmb1:

Click to download the PDB-style file with coordinates for d3qsmb1.
(The format of our PDB-style files is described here.)

Timeline for d3qsmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qsmb2