Lineage for d1i1cb2 (1i1c B:342-443)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360011Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2360159Species Norway rat (Rattus norvegicus) [TaxId:10116] [88593] (3 PDB entries)
  8. 2360161Domain d1i1cb2: 1i1c B:342-443 [21539]
    Other proteins in same PDB: d1i1ca1, d1i1cb1
    part of a Fc

Details for d1i1cb2

PDB Entry: 1i1c (more details), 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a
PDB Compounds: (B:) ig gamma-2a chain c region

SCOPe Domain Sequences for d1i1cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1cb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

SCOPe Domain Coordinates for d1i1cb2:

Click to download the PDB-style file with coordinates for d1i1cb2.
(The format of our PDB-style files is described here.)

Timeline for d1i1cb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1cb1