Lineage for d3qsba3 (3qsb A:245-366)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2976823Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 2976824Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 2976825Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 2976954Domain d3qsba3: 3qsb A:245-366 [215387]
    automated match to d1ok7a3
    protein/DNA complex; complexed with 743

Details for d3qsba3

PDB Entry: 3qsb (more details), 1.9 Å

PDB Description: structure of e. coli poliiibeta with (z)-5-(1-((4'-fluorobiphenyl-4- yl)methoxyimino)butyl)-2,2-dimethyl-4,6-dioxocyclohexanecarbonitrile
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3qsba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsba3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOPe Domain Coordinates for d3qsba3:

Click to download the PDB-style file with coordinates for d3qsba3.
(The format of our PDB-style files is described here.)

Timeline for d3qsba3: