Lineage for d3qrka1 (3qrk A:229-496)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)
  8. 2983822Domain d3qrka1: 3qrk A:229-496 [215382]
    Other proteins in same PDB: d3qrka2
    automated match to d3qrib_
    complexed with 9dp

Details for d3qrka1

PDB Entry: 3qrk (more details), 2.3 Å

PDB Description: The crystal structure of human abl1 kinase domain in complex with DP-987
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3qrka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qrka1 d.144.1.7 (A:229-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetm

SCOPe Domain Coordinates for d3qrka1:

Click to download the PDB-style file with coordinates for d3qrka1.
(The format of our PDB-style files is described here.)

Timeline for d3qrka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qrka2