SCOPe 2.03: Domain d3qrha_: 3qrh A:

Lineage for d3qrha_ (3qrh A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [225868] (3 PDB entries)

8. Domain d3qrha_: 3qrh A: [215381]
   automated match to d1xdmb1
   complexed with g3h

Details for d3qrha_

PDB Entry: 3qrh, 2 Å

PDB Description: Crystal structure of fructose bisphosphate aldolase from Encephalitozoon Cuniculi, bound to glyceraldehyde 3-phosphate

PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3qrha_:

Sequence; same for both SEQRES and ATOM records:

>d3qrha_ c.1.10.0 (A:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
mdcdhllrlgmtakkilengkgilaadetpktlgrrfeklgitnteenrrkfreilfstk
gieryiggvilnqetfeqtsgsgvpltellkkkgieigikldkglidykekekisvgled
ldlrckssafkdatfakwrslfyfydgipsedcinencsilakyaiicqknglvpivepe
vflegdysmkrsyevtrqilstlmkylnyelvyipgvlikasyvtsgqlsnekytpkkva
tftlrallstipcgipgivflsgghgsedaigflnainmergcrtwslsfsfaraltdgv
letwrgddsnieeaqkilletsfkacrgaegklwdqe

Timeline for d3qrha_:

• d3qrha_ is new in SCOPe 2.03-stable
  
• d3qrha_ appears in SCOPe 2.04
  
• d3qrha_ appears in the current release, SCOPe 2.08