Lineage for d3qrha_ (3qrh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836318Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [225868] (3 PDB entries)
  8. 2836320Domain d3qrha_: 3qrh A: [215381]
    automated match to d1xdmb1
    complexed with g3h

Details for d3qrha_

PDB Entry: 3qrh (more details), 2 Å

PDB Description: Crystal structure of fructose bisphosphate aldolase from Encephalitozoon Cuniculi, bound to glyceraldehyde 3-phosphate
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3qrha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qrha_ c.1.10.0 (A:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
mdcdhllrlgmtakkilengkgilaadetpktlgrrfeklgitnteenrrkfreilfstk
gieryiggvilnqetfeqtsgsgvpltellkkkgieigikldkglidykekekisvgled
ldlrckssafkdatfakwrslfyfydgipsedcinencsilakyaiicqknglvpivepe
vflegdysmkrsyevtrqilstlmkylnyelvyipgvlikasyvtsgqlsnekytpkkva
tftlrallstipcgipgivflsgghgsedaigflnainmergcrtwslsfsfaraltdgv
letwrgddsnieeaqkilletsfkacrgaegklwdqe

SCOPe Domain Coordinates for d3qrha_:

Click to download the PDB-style file with coordinates for d3qrha_.
(The format of our PDB-style files is described here.)

Timeline for d3qrha_: