![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88588] (3 PDB entries) |
![]() | Domain d1i1cb1: 1i1c B:239-341 [21538] Other proteins in same PDB: d1i1ca2, d1i1cb2 part of a Fc |
PDB Entry: 1i1c (more details), 2.7 Å
SCOPe Domain Sequences for d1i1cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1cb1 b.1.1.2 (B:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns tlrsvselpiverdwlngktfkckvnsgafpapieksiskpeg
Timeline for d1i1cb1: