| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (3 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
| Domain d3qrbb1: 3qrb B:1-101 [215377] automated match to d1ncja1 complexed with ca, edo, pge |
PDB Entry: 3qrb (more details), 1.8 Å
SCOPe Domain Sequences for d3qrbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qrbb1 b.1.6.1 (B:1-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
dwviaaiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwl
kvtqpldreaiakyilyshavssngeavedpmeivitvtdq
Timeline for d3qrbb1: