Lineage for d1i1ca2 (1i1c A:342-443)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655921Species Rat (Rattus norvegicus) [TaxId:10116] [88593] (2 PDB entries)
  8. 655922Domain d1i1ca2: 1i1c A:342-443 [21537]
    Other proteins in same PDB: d1i1ca1, d1i1cb1

Details for d1i1ca2

PDB Entry: 1i1c (more details), 2.7 Å

PDB Description: non-fcrn binding fc fragment of rat igg2a
PDB Compounds: (A:) ig gamma-2a chain c region

SCOP Domain Sequences for d1i1ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]}
tprgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtd
gsyflysklnvkketwqqgntftcsvlheglenehtekslsh

SCOP Domain Coordinates for d1i1ca2:

Click to download the PDB-style file with coordinates for d1i1ca2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1ca1